PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 357aa    MW: 36046.9 Da    PI: 8.6613
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003107.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3964125263
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                 kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Do003107.1  64 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 125
                 7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2563113IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3366122IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05968122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEEMLMAGNT NPNQNPSPPP AAPSAPGAQR ATGAPAAAAA APGAGAAPGA GAGAGTERRA  60
RPQKEKALNC PRCNSTNTKF CYYNNYSLQQ PRYFCKTCRR YWTEGGSLRN VPVGGGSRKN  120
KRSSSAVSSA AAAAVSTSAA VSGTIPVGLA AKNPKLMHEG AHDLNLAFPH HNGRGLQPPE  180
FTAFPSLESS SVCNPGATMT GNGAAGRGVG ALSAMELLRS TGCYVPLQHV HLGMPPEYAA  240
AGFALGDFRM PPPPQSQSVL GFSLDTHGTG AGGYSAGLQG VQESAAGRLL FPFEDLKPAV  300
NAGGGANNGA ADQYEHSKDQ AGDGSGASGV TGGHETPGFW SNSMIGNGSS NGGGGHW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824100.0KC582410.1 Sorghum bicolor dof16 protein (dof16) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953427.11e-166PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLK3YTM31e-167K3YTM3_SETIT; Uncharacterized protein
STRINGSi017619m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.19e-34Dof family protein